Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Peroxisome biogenesis protein 22 (PEX22)

This Recombinant Arabidopsis thaliana Peroxisome biogenesis protein 22 (PEX22) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Peroxisome biogenesis protein 22, Peroxin-22, AtPEX22

UniProt

Q9LSX7

Expression Region

1-283

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAESSSPSPTEEIVRLIKRLSAYVAFKMSSLFSTTSIRNLDSRSIGAIAGLAIAVIFTWR AIRTPGEQRQRRQPKRRIHNAETSSAAAAASQSNLASSVAPEVSSPREDNAVQDVVDQFF QPVKPTLGQIVRQKLSEGRKVTCRLLGVILEETSPEELQKQATVRSSVLEVLLEITKYSD LYLMERVLDDESEAKVLQALENAGVFTSGGLVKDKVLFCSTEIGRTSFVRQLEPDWHIDT NPEISTQLARFIKYQLHVATVKPERTAPNVFTSQSIEQFFGSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR450), CF740 conjugate, 0.1mg/mL
BNC740450-100 1x 100 µL

EGFR (GFR450), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), CF405S conjugate, 0.1mg/mL
BNC040486-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF647 conjugate, 0.1mg/mL
BNC472146-100 1x 100 µL

PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details