Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apocytochrome f (petA)

This Recombinant Apocytochrome f (petA) spans the amino acid sequence from region 38-321.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

P48123

Expression Region

38-321

Origin

Cyanophora paradoxa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FPIYAQQAYQIPREATGRIVCANCHLGKKPVEIEVPQAVLPNTVFEAVVKIPIDKGAQQI QANGQKGPLNVGAVLMLPEGFKLAPAERLSEELKAKTAGLYFQPYSADKENILVIGPIPG DKNQEIIFPILSPNPETNKNVKYLKYQLHVGGNRGRGQVSPTGEKTNNTIYNASVNGRIS EITKLENGGYEITITTKNGESKIETIPAGPSLVVKKGQTIKADQPLTIDPNVGGFGQMDT EIVLQSAGRVQGLIAFFISVVLAQIFLVLKKKQFEKVQAAEMNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-500 1x 500 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF568 conjugate, 0.1mg/mL
BNC681365-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10 + C1A/711), CF594 conjugate, 0.1mg/mL
BNC940717-500 1x 500 µL

CD1a (O10 + C1A/711), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details