Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ubiquinol oxidase subunit 2 (cyaB)

This Recombinant Ubiquinol oxidase subunit 2 (cyaB) spans the amino acid sequence from region 24-307.

Product Specifications

Product Name Alternative

Ubiquinol oxidase subunit 2, EC= 1.10.3.-, Cytochrome A1 subunit 2, Oxidase BA (3) subunit 2, Ubiquinol oxidase polypeptide II

UniProt

P50653

Expression Region

24-307

Origin

Acetobacter aceti

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CELDVLDPKGPVGEGVKTLIATSTVAMLIVVIPTILETLLFAWQYRQSNTSAEYLPKWCH SNKIEVTIWGVPSLIILFLAVITYQTCHSLDPYKPLEAEANTKPLHVEVVALDWKWLFIY PEQGIATVNQLAIPVNTPIDFNITSDSVMNSFFIPRLGSMIYAMAGMQTQLHLLASEPGD YLGESANYSGRGFSDMKFHTLAVSGDEFNAWVEKVKSSSEQLDSQTYPKLAAPSENPVEY FAHVEPGMFNTIVAKYNNGMVMDKSTGKMIQVQQSAMSDMNMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-500 1x 500 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-100 1x 100 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-100 1x 100 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details