Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Apocytochrome f (petA)

This Recombinant Synechococcus sp. Apocytochrome f (petA) spans the amino acid sequence from region 28-311.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q3AWL6

Expression Region

28-311

Origin

Synechococcus sp. (strain CC9902)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYDSPREATGKIVCANCHIAKKLTQAEVPQSVLPDSVFTASVKVPYEEGIKEI GADGSEVQLQVGAVVMLPDGFTLAPQDRWTDEIKEETEGVYFTQYSDEQPNILLVGPIPG DQNQEIVFPVLSPDPATDSNIHFGKYQIHVGGNRGRGQVYPTGEKSNNTVFTAPAEGKVA SIDAGDNGASVVTIQAADGTSTSETIPVGPQLLVNVGDSVAAGDAITNDPNVGGFGQVDA EIVLQNPVRIYGLLAFFAAVAIAQIMLVLKKRQIEKVQAAEGNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1870), CF640R conjugate, 0.1mg/mL
BNC401870-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1870), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL
BNC402984-500 1x 500 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details