Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apocytochrome f (petA)

This Recombinant Apocytochrome f (petA) spans the amino acid sequence from region 29-312.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q4G3D7

Expression Region

29-312

Origin

Emiliania huxleyi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPVFAQQAYDNPREATGRIVCANCHLAQKPTEVEVPQAVLPDTVFEAVVNIPYDTKVQQV TASGTPGPLNVGAVVILPEGFKLAPKGRMSDELKAKTKGVFVQPYSKTRPNILVVGPILG EKNREVTFPILAPDPAQDKSVHYLNYPIYVGANRGRGQVYPSGEKSNNNTFTSTAAGKVT AIEAGDKGTTRVTIQTAAGEAKEQTVPAGLKVSVKTGDVIQADQALSYNPNVGGFGQAET EVILQSPNRVKGMIAFFFTVTVAQILLVLKKKQFEKVQAAEMNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR559237 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Rat Adiponectin (ADP) ELISA Kit
RDR-ADP-Ra-01 96 Tests

Rat Adiponectin (ADP) ELISA Kit

Sign In for Pricing
View Details
Rat Adiponectin (ADP) ELISA Kit
RDR-ADP-Ra-02 48 Tests

Rat Adiponectin (ADP) ELISA Kit

Sign In for Pricing
View Details
FGFBP1 Human Gene Knockout Kit (CRISPR)
KN200819BN 1 Kit

FGFBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Sheep IgG, Fc Specific,  5nm
GAF-552-5 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Sheep IgG, Fc Specific, 5nm

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS800343 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details