Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apocytochrome f (petA)

This Recombinant Apocytochrome f (petA) spans the amino acid sequence from region 29-312.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q4G3D7

Expression Region

29-312

Origin

Emiliania huxleyi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPVFAQQAYDNPREATGRIVCANCHLAQKPTEVEVPQAVLPDTVFEAVVNIPYDTKVQQV TASGTPGPLNVGAVVILPEGFKLAPKGRMSDELKAKTKGVFVQPYSKTRPNILVVGPILG EKNREVTFPILAPDPAQDKSVHYLNYPIYVGANRGRGQVYPSGEKSNNNTFTSTAAGKVT AIEAGDKGTTRVTIQTAAGEAKEQTVPAGLKVSVKTGDVIQADQALSYNPNVGGFGQAET EVILQSPNRVKGMIAFFFTVTVAQILLVLKKKQFEKVQAAEMNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CSK/C-Src kinase Protein (GST Tag)
PKSH030386 50 µg

Recombinant Human CSK/C-Src kinase Protein (GST Tag)

Sign In for Pricing
View Details
4-Amino-2-ethoxy-5-nitrobenzoic Acid
TRC-A608980-1G 1 g

4-Amino-2-ethoxy-5-nitrobenzoic Acid

Sign In for Pricing
View Details
C9orf16 (NM_024112) Human Recombinant Protein
TP304030 20 µg

C9orf16 (NM_024112) Human Recombinant Protein

Sign In for Pricing
View Details
Phenetrazine Hydrochloride
TRC-P296330-50MG 50 mg

Phenetrazine Hydrochloride

Sign In for Pricing
View Details
Metolachlor ESA-d6 Sodium Salt
TRC-M338862-1MG 1 mg

Metolachlor ESA-d6 Sodium Salt

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF405S conjugate, 0.1mg/mL
BNC042958-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details