Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apocytochrome f (petA)

This Recombinant Apocytochrome f (petA) spans the amino acid sequence from region 35-318.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q8M9X2

Expression Region

35-318

Origin

Chaetosphaeridium globosum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FPIYAQQNYENPREATGRIVCANCHLAKGPVDIEVPKTVFPDTVFEAVVKIPYDTQIKQV LANGKKGGLNVGAVLILPEGFQLAPSDRIPAEIKEKIGNLAFQPYSEDKKNLLVIGPIPG KTYQEIIFPILSPDPNVNKESNFLKYPIYVGGNRGRGQVYPDGSKSNNNVFNSPATGKIT KIVDNKKAGFELSITTVDGSSIVEIIPPGATFLVSEGDSVKIDQPLTTNPNVGGFGQADG EIVLQDPARLQGLLVFLFLVVLAQVFLVLKKKQYEKVQLAEMNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-100 1x 100 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-100 1x 100 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-100 1x 100 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (MUC5AC/917 + 45M1), CF640R conjugate, 0.1mg/mL
BNC401134-100 1x 100 µL

Mucin 5AC (MUC5AC) (MUC5AC/917 + 45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/777), CF640R conjugate, 0.1mg/mL
BNC400777-100 1x 100 µL

Chromogranin A (CHGA/777), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details