Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yfhR (yhfR)

This Recombinant Uncharacterized protein yfhR (yhfR) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Uncharacterized protein yfhR

UniProt

Q8XA81

Expression Region

1-284

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALPVNKRVPKILFILFVVAFCVYLVPRVAINFFYYPDDKIYGPDPWSAESVEFTAKDGT RLQGWFIPSSTGPADNAIATIIHAHGNAGNMSAHWPLVSWLPERNFNVFMFDYRGFGKSK GTPSQAGLLDDTQSAINVVRHRSDVNPQRLVLFGQSIGGANILAVIGQGDREGIRAVILD STFASYATIANQMIPGSGYLLDESYSGENYIASVSPIPLLLIHGKADHVIPWQHSEKLYS LAKEPKRLILIPDGEHIDAFSDRHGDVYREQMVNFILSALNPQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon: rectosigmoid
CR561959 5 µg

Tissue Total RNA, Colon: rectosigmoid

Sign In for Pricing
View Details
Chrna10 Mouse Gene Knockout Kit (CRISPR)
KN503304 1 Kit

Chrna10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD8 beta Recombinant Rabbit monoclonal Antibody
HA751259 100 µL

CD8 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR562417 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
MYOD1 (NM_002478) Human Over-expression Lysate
LY400881 100 µg

MYOD1 (NM_002478) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216L-01 50 Tests

Elab Fluor® 488 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details