Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apocytochrome f (petA)

This Recombinant Apocytochrome f (petA) spans the amino acid sequence from region 37-320.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q9TLS4

Expression Region

37-320

Origin

Cyanidium caldarium

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPIYAQQTYENPRESTGRIVCANCHLAQKNIYIEAPKEVLPNTVFETVVKIPYEFNKKQI LGNGSKGDLNVGAVVILPEGFKLAPKDRMDEKLLKKTKNLYFNNYSQKLDNIIVIGPITG KDNQEITFPILAPDPQINKNTHFLKYSIYVGANKGRGQLYPSGEKSNNNPIPSNAEGRIE KIKPNEDGGYEVIIKTKDDETISQYVPIGLNLTIKEGQRIKAGEYITTDPNVGGFGQSEI EIVLQNPTRLISFIFFSISVLISQLFFVLKKKQFEKVQSLNQNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-100 1x 100 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-500 1x 500 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-100 1x 100 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF640R conjugate, 0.1mg/mL
BNC402624-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF647 conjugate, 0.1mg/mL
BNC471950-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/1097), CF647 conjugate, 0.1mg/mL
BNC471097-500 1x 500 µL

CD44 Standard (HCAM/1097), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details