Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosynechococcus elongatus Apocytochrome f (petA)

This Recombinant Thermosynechococcus elongatus Apocytochrome f (petA) spans the amino acid sequence from region 28-311.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

P0C8N5

Expression Region

28-311

Origin

Thermosynechococcus elongatus (strain BP-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFYAQQGYESPREATGRIVCANCHLAAKPIQVEVPQAVTPDSVFEAVVKIPYDTSVQQV LGDGSKGGLNVGAVLMLPEGFKIAPPDRLPEELQAKTSGIYYQPYSDDQQNIILVGPLPG EQYQEIVFPILAPNPGTDKSIHFGKYAVHAGGNRGRGQVYPNGEKSNNNVFTAPIAGTIT SITPNPDGSTAVVITPENGEAVTETVPAGPELIVREGQTVVAGAALTNNPNVGGFGQKDT EIVLQDPNRIKWLLVFFAAITLSQILLVLKKKQVEKVQAAEMSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC709), CF488A conjugate, 0.1mg/mL
BNC880709-500 1x 500 µL

Human Kappa Light Chain (KLC709), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF640R conjugate, 0.1mg/mL
BNC401982-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF640R conjugate, 0.1mg/mL
BNC401784-500 1x 500 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details