Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein UL6 (UL6)

This Recombinant Human cytomegalovirus Uncharacterized protein UL6 (UL6) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Uncharacterized protein UL6

UniProt

P16720

Expression Region

1-284

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHAKMNGWAGVRLVTHCLNTRSRTYVALNMLAFARTPRGVPSCLFNKVWVSRYALVLILM VCASESSTSWAVTSNRLPNCSTITTTAGQDAELHGPAPLSCNVTQWGRYENGSTPVLWCT LWGSRTRVSLGHRVAFGCSWKTFFIYNVSESSGGTYYQKGYNCTDKHITLSCFNLTVVPR AVQSTTTVMTPTVVTNSTFSVSLVASRLTTNSSAFRHASYQRQQRVGNGTLSKNITNLAF TYGSWGVAMLLFAAVMVLVDLGLPQSAWRRWRSHVDDEERGLLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC22D1 Antibody
8C11099-AAT 50 µg

TSC22D1 Antibody

Sign In for Pricing
View Details
Cox20 (NM_025511) Mouse Tagged ORF Clone
MG200523 10 µg

Cox20 (NM_025511) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CPXM1 Antibody
KC-7449-01 50 μL

CPXM1 Antibody

Sign In for Pricing
View Details
CPXM1 Antibody
KC-7449-02 100 µL

CPXM1 Antibody

Sign In for Pricing
View Details
CPXM1 Antibody
KC-7449-03 1 mL

CPXM1 Antibody

Sign In for Pricing
View Details
Apol9b Mouse Gene Knockout Kit (CRISPR)
KN501435 1 Kit

Apol9b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details