Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein UL6 (UL6)

This Recombinant Human cytomegalovirus Uncharacterized protein UL6 (UL6) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Uncharacterized protein UL6

UniProt

P16720

Expression Region

1-284

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHAKMNGWAGVRLVTHCLNTRSRTYVALNMLAFARTPRGVPSCLFNKVWVSRYALVLILM VCASESSTSWAVTSNRLPNCSTITTTAGQDAELHGPAPLSCNVTQWGRYENGSTPVLWCT LWGSRTRVSLGHRVAFGCSWKTFFIYNVSESSGGTYYQKGYNCTDKHITLSCFNLTVVPR AVQSTTTVMTPTVVTNSTFSVSLVASRLTTNSSAFRHASYQRQQRVGNGTLSKNITNLAF TYGSWGVAMLLFAAVMVLVDLGLPQSAWRRWRSHVDDEERGLLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nystose Trihydrate
TRC-N489153-250MG 250 mg

Nystose Trihydrate

Sign In for Pricing
View Details
CCM2 (NM_001167934) Human Over-expression Lysate
LY432976 100 µg

CCM2 (NM_001167934) Human Over-expression Lysate

Sign In for Pricing
View Details
TAQuest™ FAST qPCR Master Mix for TaqMan Probes *No ROX*
17288-AAT 1 mL

TAQuest™ FAST qPCR Master Mix for TaqMan Probes *No ROX*

Sign In for Pricing
View Details
LCOR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D10]
TA808021BM 100 µL

LCOR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D10]

Sign In for Pricing
View Details
Fluorescent Brightener 134 (Technical Grade)
TRC-F597825-50MG 50 mg

Fluorescent Brightener 134 (Technical Grade)

Sign In for Pricing
View Details
1,5-Diamino-2-chloro-4,8-dihydroxy-9,10-anthracenedione
TRC-D678823-100MG 100 mg

1,5-Diamino-2-chloro-4,8-dihydroxy-9,10-anthracenedione

Sign In for Pricing
View Details