Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein UL6 (UL6)

This Recombinant Human cytomegalovirus Uncharacterized protein UL6 (UL6) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Uncharacterized protein UL6

UniProt

P16720

Expression Region

1-284

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHAKMNGWAGVRLVTHCLNTRSRTYVALNMLAFARTPRGVPSCLFNKVWVSRYALVLILM VCASESSTSWAVTSNRLPNCSTITTTAGQDAELHGPAPLSCNVTQWGRYENGSTPVLWCT LWGSRTRVSLGHRVAFGCSWKTFFIYNVSESSGGTYYQKGYNCTDKHITLSCFNLTVVPR AVQSTTTVMTPTVVTNSTFSVSLVASRLTTNSSAFRHASYQRQQRVGNGTLSKNITNLAF TYGSWGVAMLLFAAVMVLVDLGLPQSAWRRWRSHVDDEERGLLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadonilimab Biosimilar - Research Grade
ICH5208-20mg 20 mg

Cadonilimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Esa1 (FLOT2) Human Gene Knockout Kit (CRISPR)
KN420884 1 Kit

Esa1 (FLOT2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Hydroxy-TEMPO Benzoate, Free Radical
TRC-H977023-500MG 500 mg

4-Hydroxy-TEMPO Benzoate, Free Radical

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2511), CF647 conjugate, 0.1mg/mL
BNC472511-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2511), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CCDC153 activation kit by CRISPRa
GA116990 1 Kit

Human CCDC153 activation kit by CRISPRa

Sign In for Pricing
View Details
CLCA2 (NM_006536) Human Recombinant Protein
TP307731M 100 µg

CLCA2 (NM_006536) Human Recombinant Protein

Sign In for Pricing
View Details