Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Apocytochrome f (petA)

This Recombinant Marchantia polymorpha Apocytochrome f (petA) spans the amino acid sequence from region 36-320.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

P06246

Expression Region

36-320

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FPIYAQQGYENPREATGRIVCANCHLAKKPVDIEVPQSVLPNTVFEAVVKIPYDMQIKQV LANGKKGSLNVGAVLILPEGFELAPSDRIPPEMKEKIGNLFFQPYSNDKKNILVIGPVPG KKYSEMVFPILSPDPATNKEAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASITGKVS KIFRKEKGGYEITIDDISDGHKVVDISAAGPELIISEGELVKVDQPLTNNPNVGGFGQGD AEVVLQDPLRIQGLLLFFGSVILAQIFLVLKKKQFEKVQLAEMNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-500 1x 500 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF647 conjugate, 0.1mg/mL
BNC471887-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D1 (DCS-6), CF740 conjugate, 0.1mg/mL
BNC740007-100 1x 100 µL

Cyclin D1 (DCS-6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details