Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta gronovii Apocytochrome f (petA)

This Recombinant Cuscuta gronovii Apocytochrome f (petA) spans the amino acid sequence from region 36-320.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A7M910

Expression Region

36-320

Origin

Cuscuta gronovii (Common dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPLFAQQGYENPREATGRIVCANCHLANKPVNIEVPQAILPDTVFEAVVQIPYDLQLKQV LSNGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLYFQSYRPNIKNIFVVGPVPG QKYTKITFPILSPNPANNRRAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVFNATASGRVK KIIRNQKGGYEIIINDGSDSNEVVNLLPPGLEPLVSEGESIKLDQPLTSNPNVGGFGQDV AEVVLQDPSRVQVLLFFFASIILAQIFLVLKKKQFEKVQLTKINL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-100 1x 100 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2398), CF568 conjugate, 0.1mg/mL
BNC682398-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/2398), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details