Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein unc-1 (unc-1)

This Recombinant Protein unc-1 (unc-1) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Protein unc-1, Uncoordinated protein 1

UniProt

Q21190

Expression Region

1-285

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNKERTEPQWVTPSSNQDVPPDYETIGTIFGYALQALSWILIIVTFPFSMCVCLKVIKE YERVVIFRIGRLVFGGARGPGMIFIIPCIDTYRKIDLRVVSYAVPPQEILSKDSVTVSVD AVVYFRTSDPIASVNNVDDAIYSTKLLAQTTLRNALGMKTLTEMLTEREAIAQLCETILD EGTEHWGVKVERVEVKDIRLPQQLTRAMAAEAEAAREARAKVVAAEGEQKASRALKEAAD VIQANPVALQLRHLQALNSIAAEHNSTIVFPVPVEMFGAFMKKDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

W 54011
TRC-W400130-1MG 1 mg

W 54011

Sign In for Pricing
View Details
NEDD4 Mouse Monoclonal Antibody [Clone ID: OTI7A1]
CF812647 100 µg

NEDD4 Mouse Monoclonal Antibody [Clone ID: OTI7A1]

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2747R), CF640R conjugate, 0.1mg/mL
BNC402747-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2747R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3,5-Dinitro-o-toluic Acid
TRC-D480873-5G 5 g

3,5-Dinitro-o-toluic Acid

Sign In for Pricing
View Details
PRSS55 (NM_001197020) Human Over-expression Lysate
LY434116 100 µg

PRSS55 (NM_001197020) Human Over-expression Lysate

Sign In for Pricing
View Details
Fluorescence Immunoassay Analyzer BANA-1203
BANA-1203 1 Unit

Fluorescence Immunoassay Analyzer BANA-1203

Sign In for Pricing
View Details