Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein unc-1 (unc-1)

This Recombinant Protein unc-1 (unc-1) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

Protein unc-1, Uncoordinated protein 1

UniProt

Q21190

Expression Region

1-285

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNKERTEPQWVTPSSNQDVPPDYETIGTIFGYALQALSWILIIVTFPFSMCVCLKVIKE YERVVIFRIGRLVFGGARGPGMIFIIPCIDTYRKIDLRVVSYAVPPQEILSKDSVTVSVD AVVYFRTSDPIASVNNVDDAIYSTKLLAQTTLRNALGMKTLTEMLTEREAIAQLCETILD EGTEHWGVKVERVEVKDIRLPQQLTRAMAAEAEAAREARAKVVAAEGEQKASRALKEAAD VIQANPVALQLRHLQALNSIAAEHNSTIVFPVPVEMFGAFMKKDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mms2 Antibody
MBS8245642-01 0.03 mL

Anti-Mms2 Antibody

Sign In for Pricing
View Details
Anti-Mms2 Antibody
MBS8245642-02 0.05 mL

Anti-Mms2 Antibody

Sign In for Pricing
View Details
Anti-Mms2 Antibody
MBS8245642-03 0.1 mL

Anti-Mms2 Antibody

Sign In for Pricing
View Details
Anti-Mms2 Antibody
MBS8245642-04 0.2 mL

Anti-Mms2 Antibody

Sign In for Pricing
View Details
Anti-Mms2 Antibody
MBS8245642-05 5x 0.2 mL

Anti-Mms2 Antibody

Sign In for Pricing
View Details
STAT4 (NM_003151) Human Over-expression Lysate
LS006775 100 µg

STAT4 (NM_003151) Human Over-expression Lysate

Sign In for Pricing
View Details