Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eucalyptus globulus subsp. globulus Apocytochrome f (petA)

This Recombinant Eucalyptus globulus subsp. globulus Apocytochrome f (petA) spans the amino acid sequence from region 36-320.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q49KY5

Expression Region

36-320

Origin

Eucalyptus globulus subsp. globulus (Tasmanian blue gum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQV LANGKRGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKKNILVIGPVSG QKYSEVTFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGVVS KIIRKEKGGYEITISDASDERQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79a (IGA/1688R), Biotin conjugate, 0.1mg/mL
BNCB1688-100 1x 100 µL

CD79a (IGA/1688R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS507801 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
KAT3B / p300 Recombinant Rabbit monoclonal Antibody
HA723737 100 µL

KAT3B / p300 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
alpha Synuclein (SNCA) (1-140) Mouse Monoclonal Antibody [Clone ID: 4B4]
AM26402PU-L 500 µg

alpha Synuclein (SNCA) (1-140) Mouse Monoclonal Antibody [Clone ID: 4B4]

Sign In for Pricing
View Details
KLF2 (N-term) Goat Polyclonal Antibody
AP32695PU-N 100 µg

KLF2 (N-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS500607 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details