Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eucalyptus globulus subsp. globulus Apocytochrome f (petA)

This Recombinant Eucalyptus globulus subsp. globulus Apocytochrome f (petA) spans the amino acid sequence from region 36-320.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q49KY5

Expression Region

36-320

Origin

Eucalyptus globulus subsp. globulus (Tasmanian blue gum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQV LANGKRGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKKNILVIGPVSG QKYSEVTFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGVVS KIIRKEKGGYEITISDASDERQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lmx1a Rabbit Polyclonal Antibody
AP11391PU-N 400 µL

Lmx1a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR56B4 Antibody
8G470-AAT 50 µg

OR56B4 Antibody

Sign In for Pricing
View Details
MIRO2 (RHOT2) Rabbit Polyclonal Antibody
TA380922 100 µL

MIRO2 (RHOT2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ortho-Topolin Riboside
TRC-T540285-250MG 250 mg

ortho-Topolin Riboside

Sign In for Pricing
View Details
PRKY Antibody
8C18602-AAT 50 µg

PRKY Antibody

Sign In for Pricing
View Details
PLCL1 (NM_006226) Human Over-expression Lysate
LY432418 100 µg

PLCL1 (NM_006226) Human Over-expression Lysate

Sign In for Pricing
View Details