Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eucalyptus globulus subsp. globulus Apocytochrome f (petA)

This Recombinant Eucalyptus globulus subsp. globulus Apocytochrome f (petA) spans the amino acid sequence from region 36-320.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q49KY5

Expression Region

36-320

Origin

Eucalyptus globulus subsp. globulus (Tasmanian blue gum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQVKQV LANGKRGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKKNILVIGPVSG QKYSEVTFPILSPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGVVS KIIRKEKGGYEITISDASDERQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CDC14C activation kit by CRISPRa
GA116171 1 Kit

Human CDC14C activation kit by CRISPRa

Sign In for Pricing
View Details
ABAT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7C4]
TA806964BM 100 µL

ABAT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7C4]

Sign In for Pricing
View Details
Eph receptor B1 (EPHB1) Human Knockdown Lysate
LY300158 100 µg

Eph receptor B1 (EPHB1) Human Knockdown Lysate

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), CF488A conjugate, 0.1mg/mL
BNC882298-100 1x 100 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDE4 (PDE4B) (NM_001037341) Human Over-expression Lysate
LY421908 100 µg

PDE4 (PDE4B) (NM_001037341) Human Over-expression Lysate

Sign In for Pricing
View Details
Dibutyltin Dilaurate
TRC-D429573-500MG 500 mg

Dibutyltin Dilaurate

Sign In for Pricing
View Details