Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Uncharacterized protein C17orf78 homolog

This Recombinant Bovine Uncharacterized protein C17orf78 homolog spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Uncharacterized protein C17orf78 homolog

UniProt

A6H7F9

Expression Region

1-286

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTILVFSLIITSYNVTKKELRDSSCQVEPLPDLFPKDVRSIRAELIREAQAEAKRPMFI QNQTVAILQCLGSGSKVKVNLVHSEKRQKVKHILKNLRVMTVPCRNSTAPPSCHLTPASK VQAGFLVTGKAFLPGVSQCKVYPVMGASSETYPSTTTSVTPGKKGEKTTKVDGFSSPLNQ DTDENLEKRKKWSIVVKVLIAVTLFVSGIAITVFVIFEVPCPSRCQQVRELCQCQRLRRR PRKEDQQPGTAESQSDTQPKKVGQEAPNSSSPKKAVEITVVHQTYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-100 1x 100 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-100 1x 100 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-500 1x 500 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-100 1x 100 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), CF640R conjugate, 0.1mg/mL
BNC402220-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/839), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), Biotin conjugate, 0.1mg/mL
BNCB0176-100 1x 100 µL

CD5 (Cris-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details