Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 39, mitochondrial (AIM39)

This Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 39, mitochondrial (AIM39) spans the amino acid sequence from region 41-326.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 39, mitochondrial

UniProt

C5E0J8

Expression Region

41-326

Origin

Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PRYVFSRPPNNKGQDGTHFFTNPQDDNGGDNSGAEGIGEAIAKQRRQKRTRFAYNLFWVS IAGVLGYSIGYKVIYKKEQSFLPLMPASRVHKLNDRDARRIGIDKIRVLSRLKVLEQLSQ HEMIKEQYGVPLLNVNTHETPNVDELTVWCEDSDPCVTGLVLEPDDGRPTIHNWYRLPYV FKWRLTHRPINIHKTINDISQNLGLTLSDVFQIITPEKVYGSFKYEYPLTSDDHYTKIWF LGEMKLGDDSLIIYKGKFHRDVTLEQIHLLRRENGKLIRYILYKNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
BNC880630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-500 1x 500 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details