Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus gattii serotype B Probable endonuclease LCL3 (LCL3)

This Recombinant Cryptococcus gattii serotype B Probable endonuclease LCL3 (LCL3) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Probable endonuclease LCL3, EC= 3.1.-.-

UniProt

E6R427

Expression Region

1-286

Origin

Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) (Filobasidiella gattii) (Cryptococcus bacillisporus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSYSPQKDPQHPTQHQQFPPTPPYPSSSVWSGNLGENPVFIGIGSAAGASALTLLGVM GYRRYWKRIKNADYVTSELLRRRAWIKGIVTSVGDGDNLRLYHTPGPFFRYPFKIRSIPT TQKGLRNETISIRIAGVDAPENAHFGNPAQPHAKESLEWLRATILGKRMRCQLLAKDQYN RIVAVPYISRRLWWDRPLPLMMLKEGMAVVYKAGGAEYGPWGLDEMLKVEAEARDAKRGL WALRKFESPGDFKARMKLKSDVSEERPEKKSPSGWIALVKRLIRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatocyte Specific (HepPar1), Biotin conjugate, 0.1mg/mL
BNCB0966-500 1x 500 µL

Hepatocyte Specific (HepPar1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lactate Dehydrogenase Recombinant Rabbit monoclonal Antibody
HA750155 100 µL

Lactate Dehydrogenase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-100 1x 100 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit
E-UNEL-H0151-01 5x 96 Tests

Uncoated Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit
E-UNEL-H0151-02 15x 96 Tests

Uncoated Human TNFRSF1A (Tumor Necrosis Factor Receptor Superfamily, Member 1A) ELISA Kit

Sign In for Pricing
View Details
ATP6V1B2 (NM_001693) Human Over-expression Lysate
LC419793 20 µg

ATP6V1B2 (NM_001693) Human Over-expression Lysate

Sign In for Pricing
View Details