Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus gattii serotype B Probable endonuclease LCL3 (LCL3)

This Recombinant Cryptococcus gattii serotype B Probable endonuclease LCL3 (LCL3) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Probable endonuclease LCL3, EC= 3.1.-.-

UniProt

E6R427

Expression Region

1-286

Origin

Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) (Filobasidiella gattii) (Cryptococcus bacillisporus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSYSPQKDPQHPTQHQQFPPTPPYPSSSVWSGNLGENPVFIGIGSAAGASALTLLGVM GYRRYWKRIKNADYVTSELLRRRAWIKGIVTSVGDGDNLRLYHTPGPFFRYPFKIRSIPT TQKGLRNETISIRIAGVDAPENAHFGNPAQPHAKESLEWLRATILGKRMRCQLLAKDQYN RIVAVPYISRRLWWDRPLPLMMLKEGMAVVYKAGGAEYGPWGLDEMLKVEAEARDAKRGL WALRKFESPGDFKARMKLKSDVSEERPEKKSPSGWIALVKRLIRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-Asn(Mtt)-OH
TRC-A790118-50MG 50 mg

Z-Asn(Mtt)-OH

Sign In for Pricing
View Details
Human PACSIN2 activation kit by CRISPRa
GA107753 1 Kit

Human PACSIN2 activation kit by CRISPRa

Sign In for Pricing
View Details
3-O-Acetyl-betulinic acid
TRC-A171023-5MG 5 mg

3-O-Acetyl-betulinic acid

Sign In for Pricing
View Details
GM CSF (CSF2) Mouse Monoclonal Antibody [Clone ID: OTI6H1]
CF807989 100 µg

GM CSF (CSF2) Mouse Monoclonal Antibody [Clone ID: OTI6H1]

Sign In for Pricing
View Details
Recombinant Human Secretogranin 3/SCG3 Protein (His Tag)
PKSH030513 100 µg

Recombinant Human Secretogranin 3/SCG3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Clusterin/ApoJ Protein (Fc & His Tag)
PKSH032261-01 10 µg

Recombinant Human Clusterin/ApoJ Protein (Fc & His Tag)

Sign In for Pricing
View Details