Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Putative type II secretion system L-type protein YghE (yghE)

This Recombinant Escherichia coli Putative type II secretion system L-type protein YghE (yghE) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Putative type II secretion system L-type protein YghE, Putative general secretion pathway L-type protein YghE

UniProt

Q46833

Expression Region

1-286

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIHQQHMRNIAQWLQENGITRATVAPDWMSIPCGFMACDAQRVICRIDECRGWSAGLALA PVMFRAQLNEQDLPLSLTVVGIAPEKLSAWAGADAERLTVTALPAITTYGEPEGNLLTGP WQPRVSYRKQWARWRVMILPILLILVALAVERGVTLWSVSEQVAQSRTQAEEQFLTLFPE QKRIVNLRSQVTMALKKYRPQADDTRLLAELSAIASTLKSASLSDIEMRGFTFDQKRQIL HLQLRAANFASFDKLRSVLATDYVVQQDALQKEGDAVSGGVTLRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFYVE19 Antibody
8C19582-AAT 50 µg

ZFYVE19 Antibody

Sign In for Pricing
View Details
DEFB104A Polyclonal Antibody
E-AB-53371-01 20 µL

DEFB104A Polyclonal Antibody

Sign In for Pricing
View Details
DEFB104A Polyclonal Antibody
E-AB-53371-02 60 µL

DEFB104A Polyclonal Antibody

Sign In for Pricing
View Details
DEFB104A Polyclonal Antibody
E-AB-53371-03 120 µL

DEFB104A Polyclonal Antibody

Sign In for Pricing
View Details
DEFB104A Polyclonal Antibody
E-AB-53371-04 200 µL

DEFB104A Polyclonal Antibody

Sign In for Pricing
View Details
GPATCH8 Antibody
KC-42402-01 50 μL

GPATCH8 Antibody

Sign In for Pricing
View Details