Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Small-conductance mechanosensitive channel (mscS)

This Recombinant Small-conductance mechanosensitive channel (mscS) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Small-conductance mechanosensitive channel

UniProt

P0C0S2

Expression Region

1-286

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Neurovascular bundle
CS627151 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
Human CSN7b (COPS7B) activation kit by CRISPRa
GA112107 1 Kit

Human CSN7b (COPS7B) activation kit by CRISPRa

Sign In for Pricing
View Details
Human VDR (Vitamin D Receptor) ELISA Kit
E-EL-H2043-01 24 Tests

Human VDR (Vitamin D Receptor) ELISA Kit

Sign In for Pricing
View Details
Human VDR (Vitamin D Receptor) ELISA Kit
E-EL-H2043-02 48 Tests

Human VDR (Vitamin D Receptor) ELISA Kit

Sign In for Pricing
View Details
Human VDR (Vitamin D Receptor) ELISA Kit
E-EL-H2043-03 96 Tests

Human VDR (Vitamin D Receptor) ELISA Kit

Sign In for Pricing
View Details
Mycophenolic Acid Acyl-Beta-D-glucuronide
TRC-M831525-5MG 5 mg

Mycophenolic Acid Acyl-Beta-D-glucuronide

Sign In for Pricing
View Details