Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Small-conductance mechanosensitive channel (mscS)

This Recombinant Small-conductance mechanosensitive channel (mscS) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Small-conductance mechanosensitive channel

UniProt

P0C0S2

Expression Region

1-286

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphotyrosine (P-Tyr) (PY265), CF405S conjugate, 0.1mg/mL
BNC040265-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY265), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-(4-Nitro-1,3-dioxoisoindolin-2-yl)pentanedioic Acid-d4
TRC-N515877-5MG 5 mg

2-(4-Nitro-1,3-dioxoisoindolin-2-yl)pentanedioic Acid-d4

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS704365 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
3,4-Diamino-2-thiophenepentanoic Acid Dihydrochloride
TRC-D527910-1MG 1 mg

3,4-Diamino-2-thiophenepentanoic Acid Dihydrochloride

Sign In for Pricing
View Details
CD66 (CEA) (C66/1030), 0.2mg/mL
BNUB1030-500 1x 500 µL

CD66 (CEA) (C66/1030), 0.2mg/mL

Sign In for Pricing
View Details
Human SHISAL1 activation kit by CRISPRa
GA113855 1 Kit

Human SHISAL1 activation kit by CRISPRa

Sign In for Pricing
View Details