Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Small-conductance mechanosensitive channel (mscS)

This Recombinant Small-conductance mechanosensitive channel (mscS) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Small-conductance mechanosensitive channel

UniProt

P0C0S3

Expression Region

1-286

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGA Protein Vector (Mouse) (pPB-N-His)
PV152967 500 ng

AGA Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Phos-Key Acrylamide
GP022-10mg 10 mg

Phos-Key Acrylamide

Sign In for Pricing
View Details
3-Bromo-3-methylbutanoic acid
FAA79888-01 50 mg

3-Bromo-3-methylbutanoic acid

Sign In for Pricing
View Details
3-Bromo-3-methylbutanoic acid
FAA79888-02 0.5 g

3-Bromo-3-methylbutanoic acid

Sign In for Pricing
View Details
HNRPDL, ID (HNRPDL, JKTBP, Heterogeneous nuclear ribonucleoprotein D-like, AU-rich element RNA-binding factor, JKT41-binding protein, Protein laAUF1) (MaxLight 490) discontinued
036670-ML490 100 µL

HNRPDL, ID (HNRPDL, JKTBP, Heterogeneous nuclear ribonucleoprotein D-like, AU-rich element RNA-binding factor, JKT41-binding protein, Protein laAUF1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Lentiviral human EEF1AKMT4-ECE2 sgRNA gene knockout kit - Lentiviral human EEF1AKMT4-ECE2 sgRNA gene knockout kit (100)
GTR15372058 1 Vial

Lentiviral human EEF1AKMT4-ECE2 sgRNA gene knockout kit - Lentiviral human EEF1AKMT4-ECE2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details