Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Small-conductance mechanosensitive channel (mscS)

This Recombinant Small-conductance mechanosensitive channel (mscS) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Small-conductance mechanosensitive channel

UniProt

P0C0S3

Expression Region

1-286

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NCSTN Recombinant Protein
PPT-14133 100 µg

Human NCSTN Recombinant Protein

Sign In for Pricing
View Details
ADCY6 Rabbit Polyclonal Antibody (BF555)
orb2426062 100 µL

ADCY6 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
RTP4 Antibody (C-term)
orb28448-01 50 µL

RTP4 Antibody (C-term)

Sign In for Pricing
View Details
RTP4 Antibody (C-term)
orb28448-02 100 µL

RTP4 Antibody (C-term)

Sign In for Pricing
View Details
MK7622 5mg
A12835-5 5 mg

MK7622 5mg

Sign In for Pricing
View Details
CD68 Rabbit Monoclonal Antibody (Capture)
E56PA0837 100 µL

CD68 Rabbit Monoclonal Antibody (Capture)

Sign In for Pricing
View Details