Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Small-conductance mechanosensitive channel (mscS)

This Recombinant Small-conductance mechanosensitive channel (mscS) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Small-conductance mechanosensitive channel

UniProt

P0C0S3

Expression Region

1-286

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NRIF3 Antibody (OTI4H1) [Biotin]
NBP2-73064B 0.1 mL

Mouse Monoclonal NRIF3 Antibody (OTI4H1) [Biotin]

Sign In for Pricing
View Details
Lentiviral human PSMC5 sgRNA gene knockout kit - Lentiviral human PSMC5 sgRNA gene knockout kit (25)
GTR15385404 1 Vial

Lentiviral human PSMC5 sgRNA gene knockout kit - Lentiviral human PSMC5 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Intestinal FABP Rabbit Polyclonal Antibody (Cy5.5)
orb1052238 100 µL

Intestinal FABP Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Low Sample Volume Kynurenic Acid (KYNA) ELISA Kit
abx585679-01 96 Tests

Low Sample Volume Kynurenic Acid (KYNA) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Kynurenic Acid (KYNA) ELISA Kit
abx585679-02 5x 96 Tests

Low Sample Volume Kynurenic Acid (KYNA) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Kynurenic Acid (KYNA) ELISA Kit
abx585679-03 10x 96 Tests

Low Sample Volume Kynurenic Acid (KYNA) ELISA Kit

Sign In for Pricing
View Details