Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Small-conductance mechanosensitive channel (mscS)

This Recombinant Small-conductance mechanosensitive channel (mscS) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Small-conductance mechanosensitive channel

UniProt

P0C0S3

Expression Region

1-286

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADRA1B Antibody
orb1557662-01 50 μL

ADRA1B Antibody

Sign In for Pricing
View Details
ADRA1B Antibody
orb1557662-02 100 µL

ADRA1B Antibody

Sign In for Pricing
View Details
ADRA1B Antibody
orb1557662-03 200 µL

ADRA1B Antibody

Sign In for Pricing
View Details
C130079G13Rik (NM_177661) Mouse Tagged Lenti ORF Clone
MR213415L3 10 µg

C130079G13Rik (NM_177661) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Spop Mouse shRNA Plasmid (Locus ID 20747)
TL502137 1 Kit

Spop Mouse shRNA Plasmid (Locus ID 20747)

Sign In for Pricing
View Details
Hadhb sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7587807 1.0 µg DNA

Hadhb sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details