Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ypfJ (ypfJ)

This Recombinant Uncharacterized protein ypfJ (ypfJ) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Uncharacterized protein ypfJ

UniProt

P64431

Expression Region

1-287

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWQGRRESDNVEDRRNSSGGPSMGGPGFRLPSGKGGLILLIVVLVAGYYGVDLTGLMTG QPVSQQQSTRSISPNEDEAAKFTSVILATTEDTWGQQFEKMGKTYQQPKLVMYRGMTRTG CGAGQSIMGPFYCPADGTVYIDLSFYDDMKDKLGADGDFAQGYVIAHEVGHHVQKLLGIE PKVRQLQQNATQAEVNRLSVRMELQADCFAGVWGHSMQQQGVLETGDLEEALNAAQAIGD DRLQQQSQGRVVPDSFTHGTSQQRYSWFKRGFDSGDPAQCNTFGKSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFAP2B (Transcription Factor AP-2-beta, AP2-beta, Activating Enhancer-binding Protein 2-beta, MGC21381) (MaxLight 750) discontinued
134351-ML750 100 µL

TFAP2B (Transcription Factor AP-2-beta, AP2-beta, Activating Enhancer-binding Protein 2-beta, MGC21381) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SRPK3 shRNA (h) Lentiviral Particles
sc-39233-V 200 µL

SRPK3 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Lyophilized Exosome Standards MCF7
ExoMCF7 100 Tests

Lyophilized Exosome Standards MCF7

Sign In for Pricing
View Details
RDH8 3'UTR Lenti-reporter-Luc Vector
38774081 1.0 µg

RDH8 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Hyccin (FAM126A) ELISA Kit
MBS2607581-01 48 Well

Mouse Hyccin (FAM126A) ELISA Kit

Sign In for Pricing
View Details
Mouse Hyccin (FAM126A) ELISA Kit
MBS2607581-02 96 Well

Mouse Hyccin (FAM126A) ELISA Kit

Sign In for Pricing
View Details