Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A2C7F5

Expression Region

24-310

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASWAYPFWAQQNYDNPREATGKIVCANCHLAQKTTQAEVPQSVLPDSVFKAVVKIPYKKD TTEISSDGSDVPLQVGAVVMLPDGFKLAPQDRWSEEIKEETKGVFFTQYSEEKENILLVG PLPGDNNKEIVFPILSPDPATDSSIQFGKYSIHVGGNRGRGQILPTGEKTNNNAFTATEA GTITSIKAGKNGESDIKLKTDSGKVISETIPAGPTLLVKVDDKVEAGAPLTSDPNSGGFG QLDTEVVLQNPVRIYGLLAFFVAVSLAQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

16-Deacetylfusidic Acid gamma-Lactone
TRC-D199075-25MG 25 mg

16-Deacetylfusidic Acid gamma-Lactone

Sign In for Pricing
View Details
VAMP2 (N-term) Mouse Monoclonal Antibody [Clone ID: 3E5]
AM05628PU-S 50 µL

VAMP2 (N-term) Mouse Monoclonal Antibody [Clone ID: 3E5]

Sign In for Pricing
View Details
LcH Macrobeads
MB-1401-2 1 Each

LcH Macrobeads

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF594 conjugate, 0.1mg/mL
BNC941775-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF405S conjugate, 0.1mg/mL
BNC042937-100 1x 100 µL

CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6-Bromo-2-napthoic Acid
TRC-B685930-5G 5 g

6-Bromo-2-napthoic Acid

Sign In for Pricing
View Details