Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

A2C7F5

Expression Region

24-310

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASWAYPFWAQQNYDNPREATGKIVCANCHLAQKTTQAEVPQSVLPDSVFKAVVKIPYKKD TTEISSDGSDVPLQVGAVVMLPDGFKLAPQDRWSEEIKEETKGVFFTQYSEEKENILLVG PLPGDNNKEIVFPILSPDPATDSSIQFGKYSIHVGGNRGRGQILPTGEKTNNNAFTATEA GTITSIKAGKNGESDIKLKTDSGKVISETIPAGPTLLVKVDDKVEAGAPLTSDPNSGGFG QLDTEVVLQNPVRIYGLLAFFVAVSLAQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pimelic Acid
TRC-P445040-50G 50 g

Pimelic Acid

Sign In for Pricing
View Details
basic Cytokeratin Mouse Monoclonal Antibody [Clone ID: SPM116]
AM33272PU-T 20 µg

basic Cytokeratin Mouse Monoclonal Antibody [Clone ID: SPM116]

Sign In for Pricing
View Details
ERK1 (MAPK3) Rabbit Monoclonal Antibody [Clone ID: R07-3G4]
TA384725 100 µL

ERK1 (MAPK3) Rabbit Monoclonal Antibody [Clone ID: R07-3G4]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS631574 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Zbtb20 Mouse Gene Knockout Kit (CRISPR)
KN519598 1 Kit

Zbtb20 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS506003 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details