Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 71 (Tmem71)

This Recombinant Mouse Transmembrane protein 71 (Tmem71) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Transmembrane protein 71

UniProt

Q149F5

Expression Region

1-287

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYRDSPLMSTPVANDSRSDEGPSGKLSPTCLFPSFTCDFLDGDSSFECCSIDPLTGSHYI CRRSPRLLTNGYYIWTEDSFFCDPDGHITLNPSQTSVMYKENLVRIFRKKKRTHRSLSSL LDPRASKSWLHGSIFGEVDSLPSEDLWLDGIRSLGSDLDCSLSDGWESQKPVTDTSESSS SGYILPQSLRESSQSSSLQLQVKASGHFEKNSLVHSRAGLMHKVSFQAILLAVCLVISAY TRWFVGGELASIFTCALLITIAYVVKSLFLNLARYFKATSCARFDST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Testis
CR562698 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
TCPTP (PTPN2) Human Gene Knockout Kit (CRISPR)
KN202161RB 1 Kit

TCPTP (PTPN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myosin 1C (MYO1C) (NM_001080779) Human Over-expression Lysate
LC421110 20 µg

Myosin 1C (MYO1C) (NM_001080779) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Carbonic Anhydrase IV (CA4) ELISA Kit
RDR-CA4-Hu-01 96 Tests

Human Carbonic Anhydrase IV (CA4) ELISA Kit

Sign In for Pricing
View Details
Human Carbonic Anhydrase IV (CA4) ELISA Kit
RDR-CA4-Hu-02 48 Tests

Human Carbonic Anhydrase IV (CA4) ELISA Kit

Sign In for Pricing
View Details
Caspr2 (CNTNAP2) Mouse Monoclonal Antibody [Clone ID: K67/25]
75-075 100 µL

Caspr2 (CNTNAP2) Mouse Monoclonal Antibody [Clone ID: K67/25]

Sign In for Pricing
View Details