Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 71 (Tmem71)

This Recombinant Mouse Transmembrane protein 71 (Tmem71) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Transmembrane protein 71

UniProt

Q149F5

Expression Region

1-287

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYRDSPLMSTPVANDSRSDEGPSGKLSPTCLFPSFTCDFLDGDSSFECCSIDPLTGSHYI CRRSPRLLTNGYYIWTEDSFFCDPDGHITLNPSQTSVMYKENLVRIFRKKKRTHRSLSSL LDPRASKSWLHGSIFGEVDSLPSEDLWLDGIRSLGSDLDCSLSDGWESQKPVTDTSESSS SGYILPQSLRESSQSSSLQLQVKASGHFEKNSLVHSRAGLMHKVSFQAILLAVCLVISAY TRWFVGGELASIFTCALLITIAYVVKSLFLNLARYFKATSCARFDST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843M1-01 25 µg

Elab Fluor® 700 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® 700 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843M1-02 100 µg

Elab Fluor® 700 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
(-)-Gallocatechin Gallate
TRC-G188985-25MG 25 mg

(-)-Gallocatechin Gallate

Sign In for Pricing
View Details
Bulk Anti-Human CD25 (7G7B6) Antibody
ICH1163-25mg 25 mg

Bulk Anti-Human CD25 (7G7B6) Antibody

Sign In for Pricing
View Details
Mouse Taf12 activation kit by CRISPRa
GA206795 1 Kit

Mouse Taf12 activation kit by CRISPRa

Sign In for Pricing
View Details
Villin (VIL1) Rabbit Polyclonal Antibody
TA362134 100 µL

Villin (VIL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details