Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 71 (Tmem71)

This Recombinant Mouse Transmembrane protein 71 (Tmem71) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Transmembrane protein 71

UniProt

Q149F5

Expression Region

1-287

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYRDSPLMSTPVANDSRSDEGPSGKLSPTCLFPSFTCDFLDGDSSFECCSIDPLTGSHYI CRRSPRLLTNGYYIWTEDSFFCDPDGHITLNPSQTSVMYKENLVRIFRKKKRTHRSLSSL LDPRASKSWLHGSIFGEVDSLPSEDLWLDGIRSLGSDLDCSLSDGWESQKPVTDTSESSS SGYILPQSLRESSQSSSLQLQVKASGHFEKNSLVHSRAGLMHKVSFQAILLAVCLVISAY TRWFVGGELASIFTCALLITIAYVVKSLFLNLARYFKATSCARFDST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-2 Microglobulin (B2M) (BBM.1), CF405S conjugate, 0.1mg/mL
BNC040142-500 1x 500 µL

Beta-2 Microglobulin (B2M) (BBM.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EPLIN (LIMA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F3]
TA808560AM 100 µL

EPLIN (LIMA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F3]

Sign In for Pricing
View Details
Human TMEM81 activation kit by CRISPRa
GA117994 1 Kit

Human TMEM81 activation kit by CRISPRa

Sign In for Pricing
View Details
PKA-R2β (Ab-113) Antibody
8B0972-AAT 50 µg

PKA-R2β (Ab-113) Antibody

Sign In for Pricing
View Details
UNC45B (NM_173167) Human Recombinant Protein
TP323751 20 µg

UNC45B (NM_173167) Human Recombinant Protein

Sign In for Pricing
View Details
12Beta-Hydroxyisocholic Acid
TRC-H943480-5MG 5 mg

12Beta-Hydroxyisocholic Acid

Sign In for Pricing
View Details