Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q7V653

Expression Region

24-310

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASWAYPFWAQQNYDNPREATGKIVCANCHLAQKTTQAEVPQSVLPDSVFKAVVKIPYKKD TTEISSDGSDVPLQVGAVVMLPDGFRLAPQDRWSEEIKEETKGVFFTQYSEEKENILLVG PLPGDNNKEIVFPILSPDPATDSSIQFGKYSIHVGGNRGRGQILPTGEKTNNNAFTATEA GTITSIKSGKNGESDIKLKTDSGKVISETIPAGPSLLVKVDDKVEAGAPLTSDPNSGGFG QLDTEVVLQNPVRIYGLLAFFVAVSLAQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Nicotiana tabacum 125 kDa kinesin-related protein (TKRP125), partial
MBS1144732 Inquire

Recombinant Nicotiana tabacum 125 kDa kinesin-related protein (TKRP125), partial

Sign In for Pricing
View Details
TNRC6B Rabbit Polyclonal Antibody
TA343824 100 µL

TNRC6B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Fluoro-2-[[4- (methylthio) phenoxy]methyl]benzene
PC1015328-01 250 mg

1-Fluoro-2-[[4- (methylthio) phenoxy]methyl]benzene

Sign In for Pricing
View Details
1-Fluoro-2-[[4- (methylthio) phenoxy]methyl]benzene
PC1015328-02 1 g

1-Fluoro-2-[[4- (methylthio) phenoxy]methyl]benzene

Sign In for Pricing
View Details
1-Fluoro-2-[[4- (methylthio) phenoxy]methyl]benzene
PC1015328-03 5 g

1-Fluoro-2-[[4- (methylthio) phenoxy]methyl]benzene

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor, Proto-oncogene c-ErbB-1, Receptor Tyrosine-protein Kinase erbB-1, ERBB, ERBB1, HER1, PIG61) (MaxLight 550) discontinued
143560-ML550 100 µL

EGFR (Epidermal Growth Factor Receptor, Proto-oncogene c-ErbB-1, Receptor Tyrosine-protein Kinase erbB-1, ERBB, ERBB1, HER1, PIG61) (MaxLight 550) discontinued

Sign In for Pricing
View Details