Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q7V653

Expression Region

24-310

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASWAYPFWAQQNYDNPREATGKIVCANCHLAQKTTQAEVPQSVLPDSVFKAVVKIPYKKD TTEISSDGSDVPLQVGAVVMLPDGFRLAPQDRWSEEIKEETKGVFFTQYSEEKENILLVG PLPGDNNKEIVFPILSPDPATDSSIQFGKYSIHVGGNRGRGQILPTGEKTNNNAFTATEA GTITSIKSGKNGESDIKLKTDSGKVISETIPAGPSLLVKVDDKVEAGAPLTSDPNSGGFG QLDTEVVLQNPVRIYGLLAFFVAVSLAQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANAPC5 Antibody
orb670524-01 50 µg

ANAPC5 Antibody

Sign In for Pricing
View Details
ANAPC5 Antibody
orb670524-02 100 µg

ANAPC5 Antibody

Sign In for Pricing
View Details
Recombinant Bordetella pertussis DNA mismatch repair protein MutS (mutS), partial
MBS1313392 Inquire

Recombinant Bordetella pertussis DNA mismatch repair protein MutS (mutS), partial

Sign In for Pricing
View Details
NR1I3, ID (NR1I3, CAR, Nuclear receptor subfamily 1 group I member 3, Constitutive activator of retinoid response, Constitutive androstane receptor, Orphan nuclear receptor MB67) (APC)
MBS6326524-01 0.2 mL

NR1I3, ID (NR1I3, CAR, Nuclear receptor subfamily 1 group I member 3, Constitutive activator of retinoid response, Constitutive androstane receptor, Orphan nuclear receptor MB67) (APC)

Sign In for Pricing
View Details
NR1I3, ID (NR1I3, CAR, Nuclear receptor subfamily 1 group I member 3, Constitutive activator of retinoid response, Constitutive androstane receptor, Orphan nuclear receptor MB67) (APC)
MBS6326524-02 5x 0.2 mL

NR1I3, ID (NR1I3, CAR, Nuclear receptor subfamily 1 group I member 3, Constitutive activator of retinoid response, Constitutive androstane receptor, Orphan nuclear receptor MB67) (APC)

Sign In for Pricing
View Details
KRTAP16-1 Double Nickase Plasmid (h2)
sc-418878-NIC-2 20 µg

KRTAP16-1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details