Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q7V653

Expression Region

24-310

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASWAYPFWAQQNYDNPREATGKIVCANCHLAQKTTQAEVPQSVLPDSVFKAVVKIPYKKD TTEISSDGSDVPLQVGAVVMLPDGFRLAPQDRWSEEIKEETKGVFFTQYSEEKENILLVG PLPGDNNKEIVFPILSPDPATDSSIQFGKYSIHVGGNRGRGQILPTGEKTNNNAFTATEA GTITSIKSGKNGESDIKLKTDSGKVISETIPAGPSLLVKVDDKVEAGAPLTSDPNSGGFG QLDTEVVLQNPVRIYGLLAFFVAVSLAQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Heat shock factor protein 2 HSF2 Antibody Picoband® Fluoro594 Conjugated
PA1607-Fluoro594 100 µg/Vial

Anti-Heat shock factor protein 2 HSF2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
RYBP (RING1 and YY1-binding Protein, Apoptin-associating Protein 1, AAP1, APAP-1, Death Effector Domain-associated Factor, DED-associated Factor, DEDAF, YY1 and E4TF1-associated Factor 1, YEAF1)
132909 50 µg

RYBP (RING1 and YY1-binding Protein, Apoptin-associating Protein 1, AAP1, APAP-1, Death Effector Domain-associated Factor, DED-associated Factor, DEDAF, YY1 and E4TF1-associated Factor 1, YEAF1)

Sign In for Pricing
View Details
Bovine Matrix Metalloproteinase 7 MMP-7 ELISA Kit
BG-BVN11609 1 Each

Bovine Matrix Metalloproteinase 7 MMP-7 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal LRFN5 Antibody [Janelia Fluor 549]
NBP1-77004JF549 0.1 mL

Rabbit Polyclonal LRFN5 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
TARSL2 sgRNA CRISPR Lentivector (Human) (Target 2)
K2332903 1.0 µg DNA

TARSL2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Cystatin C (CST3) Antibody Pair
abx370336-01 5x 96 Tests

Cystatin C (CST3) Antibody Pair

Sign In for Pricing
View Details