Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane and coiled-coil domain-containing protein 5A (TMCO5A)

This Recombinant Human Transmembrane and coiled-coil domain-containing protein 5A (TMCO5A) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Transmembrane and coiled-coil domain-containing protein 5A

UniProt

Q8N6Q1

Expression Region

1-288

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEISRLAQSKRNIISLNMDLERDTQRIDEANQKLLLKIQEREDKIQRLESEIIQTRGLVE DEEWEKENRTTMERERALQELEEETARLERKNKTLVHSITELQQKLTRKSQKITNCEQSS PDGALEETKVKLQQLEASYACQEKELLKVMKEYAFVTQLCEDQALYIKKYQETLKKIEEE LEALFLEREVSKLVSMNPVEKEHTSQNNEGTPTQKTARLFSKKIFCCLFFITLFFIRLLS YMFFHVRFINPDLLVNVLPKVLGRSTLWKLRCFFFPSLTLETEDMLPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-500 1x 500 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-100 1x 100 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-100 1x 100 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details