Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. Apocytochrome f (petA)

This Recombinant Nostoc sp. Apocytochrome f (petA) spans the amino acid sequence from region 45-333.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

P13626

Expression Region

45-333

Origin

Nostoc sp. (strain PCC 7906)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQTYPETPREPTGRIVCANCHLAAKPTEVEVPQSVLPDTVFKAVVKIPYDTSAQQ VGADGSKVGLNVGAVLMLPEGFKIAPEDRISEELQEEIGDTYFQPYSEDKENIVIVGPLP GEQYQEIVFPVLSPNPATDKNIHFGKYSVHVGGNRGRGQVYPTGEKSNNNLYNASATGTI AKIAKEEDEDGNVKYQVNIQPESGDVVVDTVPAGPELIVSEGQAVKAGDALTNNPNVGGF GQRDAEIVLQDAGRVKGLIAFVALVMLAQVMLVLKKKQVERVQAAEMNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-100 1x 100 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-100 1x 100 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF740 conjugate, 0.1mg/mL
BNC741687-100 1x 100 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details