Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bradyrhizobium sp. Cbb3-type cytochrome c oxidase subunit FixP (fixP)

This Recombinant Bradyrhizobium sp. Cbb3-type cytochrome c oxidase subunit FixP (fixP) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Cbb3-type cytochrome c oxidase subunit FixP, Cbb3-Cox subunit FixP, C-type cytochrome FixP, Cyt c (FixP), Cytochrome c oxidase subunit III

UniProt

A4YQU0

Expression Region

1-290

Origin

Bradyrhizobium sp. (strain ORS278)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADHSEVDSVSGTATTGHAWDGIKELNTPLPRWWVITFYITIVWAIGYWIVYPAWPTITS NTKGLFGYSSRADVAVELANLEKIRGDKMAALATASLADIEKDPQMLALARAKGKTVFGD NCAACHGTGAAGAKGFPNLNDDDWLWGGSLEQIQQTLLYGVRSGHPKTREGQMLAFGKDG TLKPAEIITVANYVRSLSGLPTRQGYDAAAGAKIFAENCVACHGDNAKGNPEVGAPNLTD KIWLYGSDEATLIETITNGRAGVMPAWEGRLDPTTIKAMAVYVHSLGGGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-100 1x 100 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-500 1x 500 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details