Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0465 (TP_0465)

This Recombinant Treponema pallidum Uncharacterized protein TP_0465 (TP_0465) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0465

UniProt

O83478

Expression Region

1-290

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQVLTVLHALSSPPWICLLSFNRMVLARQCAFVLVSCVVPCVAGAVLSSCMPFYARTEG LTLKRVYFEKAGKTDATLALHVTLEYPAPPEEYFYLEVEELRTGMRWVFGEKDTRVYIAT DELHPGRRMLRVGGMQYPWGDFPAGTYVVYVRDSTGTYAQQRVTLGAGYPAHEPFPFSFS VDAQRWTLSAPAQPALVGPFTAHTHTSLVLLTRDYRTVAQHPLSLTSLPNARLSSPRVHT FEASMDALKTTHQDAYYLQCVVEDFQRSWRFISQPHRLYPEDALSEQAPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CERCAM CRISPR All-in-one AAV vector set (with saCas9)(Human)
15926151 3x 1.0 µg DNA

CERCAM CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Mouse ALYREF Ready-To-Use IHC Kit
orb3001473 50 Tests

Mouse ALYREF Ready-To-Use IHC Kit

Sign In for Pricing
View Details
KIFAP3 Recombinant Antibody, APC Conjugated
bsm-62293R-APC-01 20 µL

KIFAP3 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
KIFAP3 Recombinant Antibody, APC Conjugated
bsm-62293R-APC-02 100 µL

KIFAP3 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
OsI_22010 Antibody
orb841652 2 mg

OsI_22010 Antibody

Sign In for Pricing
View Details
NOV/CCN3 Protein, Human, Recombinant (His)
TMPY-01307-01 5 µg

NOV/CCN3 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details