Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0465 (TP_0465)

This Recombinant Treponema pallidum Uncharacterized protein TP_0465 (TP_0465) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0465

UniProt

O83478

Expression Region

1-290

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQVLTVLHALSSPPWICLLSFNRMVLARQCAFVLVSCVVPCVAGAVLSSCMPFYARTEG LTLKRVYFEKAGKTDATLALHVTLEYPAPPEEYFYLEVEELRTGMRWVFGEKDTRVYIAT DELHPGRRMLRVGGMQYPWGDFPAGTYVVYVRDSTGTYAQQRVTLGAGYPAHEPFPFSFS VDAQRWTLSAPAQPALVGPFTAHTHTSLVLLTRDYRTVAQHPLSLTSLPNARLSSPRVHT FEASMDALKTTHQDAYYLQCVVEDFQRSWRFISQPHRLYPEDALSEQAPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAX2 3'UTR Luciferase Stable Cell Line
TU022686 1.0 mL

SCAX2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human IGLON5/IgLON family member 5 ELISA Kit
MBS2907120-01 48 Well

Human IGLON5/IgLON family member 5 ELISA Kit

Sign In for Pricing
View Details
Human IGLON5/IgLON family member 5 ELISA Kit
MBS2907120-02 96 Well

Human IGLON5/IgLON family member 5 ELISA Kit

Sign In for Pricing
View Details
Human IGLON5/IgLON family member 5 ELISA Kit
MBS2907120-03 5x 96 Well

Human IGLON5/IgLON family member 5 ELISA Kit

Sign In for Pricing
View Details
Human IGLON5/IgLON family member 5 ELISA Kit
MBS2907120-04 10x 96 Well

Human IGLON5/IgLON family member 5 ELISA Kit

Sign In for Pricing
View Details
Albumin Bovine Fraction V 98% (For Molecular Biology)
00092 00005 5 g

Albumin Bovine Fraction V 98% (For Molecular Biology)

Sign In for Pricing
View Details