Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0465 (TP_0465)

This Recombinant Treponema pallidum Uncharacterized protein TP_0465 (TP_0465) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0465

UniProt

O83478

Expression Region

1-290

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQVLTVLHALSSPPWICLLSFNRMVLARQCAFVLVSCVVPCVAGAVLSSCMPFYARTEG LTLKRVYFEKAGKTDATLALHVTLEYPAPPEEYFYLEVEELRTGMRWVFGEKDTRVYIAT DELHPGRRMLRVGGMQYPWGDFPAGTYVVYVRDSTGTYAQQRVTLGAGYPAHEPFPFSFS VDAQRWTLSAPAQPALVGPFTAHTHTSLVLLTRDYRTVAQHPLSLTSLPNARLSSPRVHT FEASMDALKTTHQDAYYLQCVVEDFQRSWRFISQPHRLYPEDALSEQAPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PacBlue Anti-human CD4 Antibody *HIT4a*
100401J1-AAT 500 Tests

PacBlue Anti-human CD4 Antibody *HIT4a*

Sign In for Pricing
View Details
Lentiviral mouse Tdp1 shRNA (UAS) - Lentiviral mouse Tdp1 shRNA (UAS, iRFP) (25)
GTR15156362 1 Vial

Lentiviral mouse Tdp1 shRNA (UAS) - Lentiviral mouse Tdp1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
C6, Mouse, pAb Antibody
orb1108745 100 µg

C6, Mouse, pAb Antibody

Sign In for Pricing
View Details
Usp24 AAV siRNA Pooled Vector
49301164 1.0 µg

Usp24 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Anti-Human PTPN6 / SHP-1 Monoclonal Antibody
TA318612 50 µL

Mouse Anti-Human PTPN6 / SHP-1 Monoclonal Antibody

Sign In for Pricing
View Details
IL12RB1 CRISPRa sgRNA lentivector (set of three targets)(Human)
24817121 3x 1.0µg DNA

IL12RB1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details