Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ergic1)

This Recombinant Danio rerio Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ergic1) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 1, ER-Golgi intermediate compartment 32 kDa protein, ERGIC-32

UniProt

Q4V8Y6

Expression Region

1-290

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFDVRRFDIYRKVPKDLTQPTYTGAFISICCCVFMLFLFLSELTGFIATEIVNELYVDD PDKDSGGKIDVSLNISLPNLHCDLVGLDIQDEMGRHEVGHIENSMKVPLNNGHGCRFEGE FSINKVPGNFHVSTHSATAQPQSPDMTHIIHKLAFGAKLQVQHVQGAFNALGGADRLQSN ALASHDYILKIVPTVYEELGGKQRFSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITV KYTERRRPFYRFITTICAIIGGTFTVAGIIDSCIFTASEAWKKIQIGKMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBV/HHV-4 LMP1/BNLF1 Human Monoclonal Antibody
orb2960542-01 50 µg

EBV/HHV-4 LMP1/BNLF1 Human Monoclonal Antibody

Sign In for Pricing
View Details
EBV/HHV-4 LMP1/BNLF1 Human Monoclonal Antibody
orb2960542-02 100 µg

EBV/HHV-4 LMP1/BNLF1 Human Monoclonal Antibody

Sign In for Pricing
View Details
EBV/HHV-4 LMP1/BNLF1 Human Monoclonal Antibody
orb2960542-03 1 mg

EBV/HHV-4 LMP1/BNLF1 Human Monoclonal Antibody

Sign In for Pricing
View Details
1- (Iodomethyl) -2-azabicyclo[2.2.1]heptan-3-one
MKD82275-01 50 mg

1- (Iodomethyl) -2-azabicyclo[2.2.1]heptan-3-one

Sign In for Pricing
View Details
1- (Iodomethyl) -2-azabicyclo[2.2.1]heptan-3-one
MKD82275-02 0.5 g

1- (Iodomethyl) -2-azabicyclo[2.2.1]heptan-3-one

Sign In for Pricing
View Details
TTLL4 (NM_014640) Human Tagged Lenti ORF Clone
RC205206L1 10 µg

TTLL4 (NM_014640) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details