Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Desulfotalea psychrophila UPF0316 protein DP2912 (DP2912)

This Recombinant Desulfotalea psychrophila UPF0316 protein DP2912 (DP2912) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

UPF0316 protein DP2912

UniProt

Q6AJ39

Expression Region

1-290

Origin

Desulfotalea psychrophila (strain LSv54 / DSM 12343)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMDFVSFFEPASLLYAAMVFLSRVVDVSFGTLRTISIVHGRTTMAFWLGFFEAAIWLVV VSTIVQTVTEQPLLVIVYALGFATGNIVGIKFERMIALGHLVLRVISRHNSNEIAYEIRE QGYAVTAFKGEGRSGIVTELYIVCRRRDMKRILKKVMALDPKAFYVSERAGEVSNVYRPI MQPMTGWRRVLKKKYHSPSSALQGFSGEGSSPSSLSQLGRAERHFPGTVLRCRPYVPFLV ISFASEMRPPDTARAFSFGQRCGLARLTPPCISQRALHGTSLSGEALVSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-100 1x 100 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details