Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gallid herpesvirus 2 Phosphoprotein pp38 (MDV073)

This Recombinant Gallid herpesvirus 2 Phosphoprotein pp38 (MDV073) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Phosphoprotein pp38

UniProt

Q77MR0

Expression Region

1-290

Origin

Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFEAEHEGLTASWVAPAPQGGKGAEGRAGVADEAGHGKTEAECAEDGEKCGDAEMSALD RVQRDRWRFSSPPPHSGVTGKGAIPIKGDGKAIECQELTGEGEWLSQWEELPPEPRRSGN EHLDESRYAKQTERGSSTGKEEGDGMKQMGELAQQCEGGTYADLLVEAEQAVVHSVRALM LAERQNPNILGEHLNKKRVLVQRPRTILSVESENATMRSYMLVTLICSAKSLLLGSCMSF FAGMLVGRTADVKTPLWDTVCLLMAFCAGIVVGGVDSGEVESGETKSESN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA-PKcs/PRKDC Mouse Monoclonal Antibody [2-B3]
M1204-6 100 µL

DNA-PKcs/PRKDC Mouse Monoclonal Antibody [2-B3]

Sign In for Pricing
View Details
Human LRRC66 activation kit by CRISPRa
GA117453 1 Kit

Human LRRC66 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF405S conjugate, 0.1mg/mL
BNC041707-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
8,10-Dihydroxy-cannabinol
TRC-D448803-5MG 5 mg

8,10-Dihydroxy-cannabinol

Sign In for Pricing
View Details
GOLPH4 (GOLIM4) Human Gene Knockout Kit (CRISPR)
KN421608 1 Kit

GOLPH4 (GOLIM4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-(Ethoxycarbonyl)thiophene-3-boronic Acid
TRC-E895058-250MG 250 mg

5-(Ethoxycarbonyl)thiophene-3-boronic Acid

Sign In for Pricing
View Details