Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gallid herpesvirus 2 Phosphoprotein pp38 (MDV073)

This Recombinant Gallid herpesvirus 2 Phosphoprotein pp38 (MDV073) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Phosphoprotein pp38

UniProt

Q77MR0

Expression Region

1-290

Origin

Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFEAEHEGLTASWVAPAPQGGKGAEGRAGVADEAGHGKTEAECAEDGEKCGDAEMSALD RVQRDRWRFSSPPPHSGVTGKGAIPIKGDGKAIECQELTGEGEWLSQWEELPPEPRRSGN EHLDESRYAKQTERGSSTGKEEGDGMKQMGELAQQCEGGTYADLLVEAEQAVVHSVRALM LAERQNPNILGEHLNKKRVLVQRPRTILSVESENATMRSYMLVTLICSAKSLLLGSCMSF FAGMLVGRTADVKTPLWDTVCLLMAFCAGIVVGGVDSGEVESGETKSESN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UBE2L5 activation kit by CRISPRa
GA116239 1 Kit

Human UBE2L5 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS620878 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
FGD4 (NM_139241) Human Over-expression Lysate
LC403384 20 µg

FGD4 (NM_139241) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
Mouse ACE (Angiotensin I Converting Enzyme) ELISA Kit
E-EL-M3013-01 24 Tests

Mouse ACE (Angiotensin I Converting Enzyme) ELISA Kit

Sign In for Pricing
View Details