Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ergic1)

This Recombinant Xenopus laevis Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ergic1) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 1, ER-Golgi intermediate compartment 32 kDa protein, ERGIC-32

UniProt

Q6NS19

Expression Region

1-290

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFITFLFLSELTGFIANEIVNELYVDD PDKDSGGKIDVTLNVTLPNLPCEVVGLDIQDEMGRHEVGHIDNSMKIPINNAYGCRFEGL FSINKVPGNFHVSTHSAIAQPANPDMRHIIHKLSFGNTLQVDNIHGAFNALGGADKLASK ALESHDYVLKIVPTVYEDLNGKQQFSYQYTVANKAYVAYSHTGRVVPAIWFRYDLSPITV KYTERRQPMYRFITTVCAIIGGTFTVAGILDSFIFTASEAWKKIQLGKMQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-100 1x 100 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details